PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG016582t1
Common NameTCM_016582
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family HD-ZIP
Protein Properties Length: 799aa    MW: 88727.9 Da    PI: 5.2261
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG016582t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.21.9e-2084139156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +++ +++t+ q++e+e++F+++++p+ ++r +L+++lgL+ rqVk+WFqNrR+++k
  Thecc1EG016582t1  84 KKRYHRHTARQIQEMEAVFKECPHPDDKQRMKLSQELGLKPRQVKFWFQNRRTQMK 139
                       688899***********************************************998 PP

2START150.31.7e-472815082206
                       HHHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS...............SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S... CS
             START   2 laeeaaqelvkkalaeepgWvkssesengdevlqkfeeskv..............dsgealrasgvvdmvlallveellddkeqWdetla... 77 
                       la + ++elvk+   +ep+W +    eng e l  +e ++               +++ea r+s+vv+m++++lv  +ld + +W+e ++   
  Thecc1EG016582t1 281 LAMSSMDELVKMCRTNEPLWIRNN--ENGRELLNLEEHARMfpwapsnlkqrsteFRTEAGRDSAVVIMNSVTLVDAFLDAN-KWTELFPsiv 370
                       677899****************99..999999999988887999999***********************************.********** PP

                       .EEEEEEEECTT.....EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE....TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTC CS
             START  78 .kaetlevissg.....galqlmvaelqalsplvp.RdfvfvRyirq...lgagdwvivdvSvdseqkppesssvvRaellpSgiliepksng 160
                        +a+t++v+s g     g lqlm+aelq+lsplvp R+ +f+Ry++q   + +  w+ivd  +d   ++  ++s+   +++pSg+li++++ng
  Thecc1EG016582t1 371 aRAKTVQVVSAGvsgtnGSLQLMYAELQVLSPLVPtREAYFLRYCQQqnlDDETYWAIVDFPIDGFHNNL-QASFPLYRRRPSGCLIQDMPNG 462
                       ***********************************************99888889*********999998.67666666************** PP

                       EEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
             START 161 hskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                       +s+vtwveh++ +++ +h+++ ++v +g+a+ga +w+a l+rqce+
  Thecc1EG016582t1 463 YSRVTWVEHAEIEEKPVHQIFSHFVYNGMAFGAHRWLAVLERQCER 508
                       ********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.6E-2070142IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-2179146IPR009057Homeodomain-like
PROSITE profilePS5007117.05481141IPR001356Homeobox domain
SMARTSM003897.9E-2082145IPR001356Homeobox domain
PfamPF000466.6E-1884139IPR001356Homeobox domain
CDDcd000864.02E-1984142No hitNo description
PROSITE patternPS000270116139IPR017970Homeobox, conserved site
PROSITE profilePS5084842.809271511IPR002913START domain
SuperFamilySSF559611.1E-28272510No hitNo description
CDDcd088757.91E-115275507No hitNo description
SMARTSM002349.9E-32280508IPR002913START domain
PfamPF018527.7E-40281508IPR002913START domain
SuperFamilySSF559614.47E-16526765No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048497Biological Processmaintenance of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 799 aa     Download sequence    Send to blast
MYGDCQVISS MGGNVVSSET LFSSPIQNPN FNFLPFQPLP PMIPKEENGL LLRGKEEMDS  60
GSGSEQVEEK SGNEQESTEQ PPKKKRYHRH TARQIQEMEA VFKECPHPDD KQRMKLSQEL  120
GLKPRQVKFW FQNRRTQMKA QQDRSDNVIL RAENESLKNE FYRLQAELSK LVCPNCGGPA  180
VPGGISFEEL RIENARLREE LERVCAIASR YIGRPIQTMG AAPALMPPSL DLDMNMYPRH  240
FTEPMASCTE MMPVPMLPET ASFPENNLVL VEEEKTVAME LAMSSMDELV KMCRTNEPLW  300
IRNNENGREL LNLEEHARMF PWAPSNLKQR STEFRTEAGR DSAVVIMNSV TLVDAFLDAN  360
KWTELFPSIV ARAKTVQVVS AGVSGTNGSL QLMYAELQVL SPLVPTREAY FLRYCQQQNL  420
DDETYWAIVD FPIDGFHNNL QASFPLYRRR PSGCLIQDMP NGYSRVTWVE HAEIEEKPVH  480
QIFSHFVYNG MAFGAHRWLA VLERQCERVA SLMARNITDL GVIPSPEARK NLMRLAQRMI  540
RTFCVNISTS SGQLWTALPD SADDTVRITT RKVTEAGQPN GLILCAVSTT WLPYPHDQVF  600
DLLRDERSRS QLEVLSNGNA LHEVAHIANG AHPGNCISLL RINVASNSSQ HVELMLQESC  660
TDRSGSLVVY STVDVDSVQL AMSGEDPSCI PLLPLGFFIT PVELIRDASD DQGKSVPPSE  720
EANGHISGSL LTVGLQVLAS TVPSAKINLS SIAAINNHLC TTVHQITAAL SSSTAPSCPD  780
NGIGVLGSCT EPASAPEK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007040684.10.0Homeobox-leucine zipper protein HDG5 isoform 1
SwissprotQ9FJS20.0HDG5_ARATH; Homeobox-leucine zipper protein HDG5
TrEMBLA0A061G5U70.0A0A061G5U7_THECC; Homeobox-leucine zipper protein HDG5 isoform 1
STRINGPOPTR_0003s09470.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM43562548
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G46880.10.0homeobox-7
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]